OSTN Antibody Blocking Peptide

CAT: 0013-GTR18992891-01Size: 100 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18992891-01Size:100 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This product is OSTN Antibody Blocking Peptide. Its molecular weight is 5.621 kDa. Its protein sequence is SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG-NH2. It targets Osteocrin. Purification is performed using HPLC.

Product Name Alternative

Musclin; OSTN; OSTN_HUMAN.

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized

Molecular Weight

5.621 kDa

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG-NH2

Related Products

Catalog	Name
GTR18978268	OSTC Antibody Blocking peptide
GTR19002096	OSTC Antibody Blocking Peptide
GTR18025209	Ostn Antibody
GTR17946764-01	OSTN Antibody
GTR18960730	OST alpha Antibody Blocking peptide
GTR17946765-01	OSTN Antibody (Biotin)
GTR17946767-01	OSTN Antibody (HRP)
GTR17946766-01	OSTN Antibody (FITC)
GTR18970809	WAS Antibody Blocking peptide
GTR18680634-01	OSTN Rabbit Polyclonal Antibody

Alternative Products

Catalog	Name
MBS9632231-01	OSTN Blocking Peptide
MBS9231566-01	Cdc14 Antibody Blocking Peptide
MBS9231461-01	p100 Antibody Blocking Peptide
MBS9219386-01	SYK Antibody Blocking peptide
MBS9218305-01	CRFR2D Antibody Blocking peptide
MBS9223211-01	ATG16L Antibody Blocking peptide
MBS9228451-01	WAS Antibody (Center) Blocking Peptide
MBS9227388-01	PAK6 Antibody Blocking Peptide
MBS9227387-01	PAK5 Antibody Blocking Peptide
MBS9227160-01	TYRO3 Antibody Blocking Peptide

OSTN Antibody Blocking Peptide

Related Products

Alternative Products

Popular Products