Products for Research Use Only
RegisterLogin

Aβ1-40 Peptide

CAT: 0013-GTR18992896-01Size: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18992896-01Size:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This product is Aβ1-40 Peptide. Its protein sequence is DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. It targets Amyloid-beta precursor protein. Purification is performed using HPLC.
Product Name Alternative
β-Amyloid 1-40; beta Amyloid (1-40) ; beta-Amyloid 1-40; beta-Amyloid 1-40; Amyloid 1-40; A4; AAA; ABETA; ABPP; AD1; Alzheimers Disease Amyloid Protein; Amyloid B; Amyloid Beta A4 Protein Precursor; Amyloid Beta; Amyloid of Aging and Alzheimer Disease; APP; APPI; B Amyloid; Beta APP; Cerebral Vascular Amyloid Peptide; CTFgamma; CVAP; PN II; PN2; PreA4; Protease nexin II; A beta; A4_HUMAN.
Field of Research
DNA / RNA Binding, DNA and RNA Research, RNA Processing
Form
Lyophilized
Storage Conditions
Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Notes
For research use only.
AA Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Related Products

CatalogName
GTR18880641-01β-Amyloid Peptide (1-40)
GTR19008154Aβ1-40 (CT) Peptide
GTR19153286-01β-Amyloid Peptide (1-40), rat
GTR18891410Beta Amyloid (40-1) peptide
GTR18869992-01Mouse Amyloid Beta Peptide 1-40 (Aβ1-40) ELISA Kit
GTR18870004-01Rat Amyloid Beta Peptide 1-40 (Aβ1-40) ELISA Kit
GTR18906531-01YKL-40 peptide
GTR18896324Connexin 40 peptide
GTR18896292-01Beta-Amyloid (1-40) Human peptide
GTR18807838-01Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

Alternative Products

CatalogName
abx670346Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide
B4592Amyloid β Peptide 1-40 (Aβ1-40) Rabbit ELISA Kit
B4589Amyloid β Peptide 1-40 (Aβ1-40) Horse ELISA Kit
B4591Amyloid β Peptide 1-40 (Aβ1-40) Mouse ELISA Kit
B4590Amyloid β Peptide 1-40 (Aβ1-40) Human ELISA Kit
B4593Amyloid β Peptide 1-40 (Aβ1-40) Rat ELISA Kit
FY-AB53001-01Anti-Amyloid Beta Peptide 1-40 (AB1-40)
TRV-033142-01Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)
SIPA477Hu01-01Recombinant Amyloid Beta Peptide 1-40 (Ab1-40)
545027Amyloid Beta Peptide 1-40

Popular Products