Products for Research Use Only
RegisterLogin

Recombinant Murine Fibroblast Growth Factor-basic (rMubFGF)

CAT: 0013-GTR18991712-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18991712-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
FGF basic (FGF-2, HBGF-2) is one of at least 22 mitogenic proteins of the FGF family, which show 35 - 60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted. Transcription from alternate start sites produces 21 - 24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH-3T3 cells.
Source
Escherichia coli.
Field of Research
Neuroscience; Stem Cell & Developmental Biology
Endotoxin
Less than 1EU/mg of rMubFGF as determined by LAL method.
Purity
>98% by SDS-PAGE and HPLC analyses.
Bioactivity
Fully biologically active when compared to standard. The ED50, as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is 1x107 units/mg.
Form
Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
Molecular Weight
Approximately 16.2 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.
Storage Conditions
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.
Preservative
Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
AA Sequence
MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Related Products

CatalogName
GTR19009988Recombinant murine Fibroblast Growth Factor-basic (rm bFGF)
GTR19033540-01Recombinant Murine Fibroblast Growth Factor 8
GTR19033539-01Recombinant Murine Fibroblast Growth factor 9
GTR19033537-01Recombinant Murine Fibroblast Growth Factor 17
GTR19033535-01Recombinant Murine Fibroblast Growth Factor 21
GTR19066416-01Recombinant Human Basic Fibroblast Growth Factor
GTR19035498-01Recombinant Murine Fibroblast Growth Factor 16
GTR19033542-01Recombinant Murine Acidic Fibroblast Growth Factor
GTR19033536-01Recombinant Murine Fibroblast Growth Factor 18
GTR19150196FIBROBLAST GROWTH FACTOR, BASIC, HUMAN

Alternative Products

CatalogName
PR2015-01Recombinant Murine Fibroblast Growth Factor-basic (rMubFGF)
JOT-PR2015Recombinant Murine Fibroblast Growth Factor-basic (rMubFGF )
GWB-A036E8Fibroblast Growth Factor-basic (FGF-Basic)
CA902-010Basic Fibroblast Growth Factor, HEK
22060016-1Bovine Fibroblast Growth Factor-Basic
546856Fibroblast Growth Factor 2, Basic
abx265368-01Basic Fibroblast Growth Factor Peptide
abx263468-01Fibroblast Growth Factor-basic Protein
MO-C40046F-01Fibroblast Growth Factor - Basic (bFGF)
048675Fibroblast Growth Factor, Basic (FGFb)

Popular Products