Products for Research Use Only
RegisterLogin

Recombinant Human Glia Maturation Factor beta (rHuGMF-β)

CAT: 0013-GTR18991693-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18991693-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
GMF-β, a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family. GMF-β appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.
Source
Escherichia coli.
Endotoxin
Less than 1EU/g of rHuGMF-b as determined by LAL method.
Purity
>98% by SDS-PAGE and HPLC analyses.
Bioactivity
Data Not Available.
Form
Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Molecular Weight
Approximately 16.5 KDa, a single non-glycosylated polypeptide chain containing 141 amino acids.
Storage Conditions
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.
Preservative
Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
AA Sequence
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNT EDLTEEWLREKLGFFH

Related Products

CatalogName
GTR19035511-01Recombinant Human Glia Maturation Factor beta
GTR19035494-01Recombinant Rat Glia Maturation Factor beta
GTR19035497-01Recombinant Murine Glia Maturation Factor beta
GTR18608480Glia maturation factor beta Antibody
GTR18991649-01Recombinant Murine Glia maturation factor beta (rMuGMF-β)
GTR18794715Glia maturation factor beta Antibody (Biotin)
GTR18794723Glia maturation factor beta Antibody (PE)
GTR18794717Glia maturation factor beta Antibody (Fluoro488)
GTR18794725Glia maturation factor beta Antibody (Fluoro647)
GTR18794722Glia maturation factor beta Antibody (APC)

Alternative Products

CatalogName
JOT-PR1033Recombinant Human Glia Maturation Factor beta (rHuGMF-β)
PR1033-01Recombinant Human Glia Maturation Factor beta (rHuGMF-β)
317249Glia maturation factor, beta
abx260749-01Glia Maturation Factor beta Protein
90147-AHuman Glia Maturation Factor beta
481934GMFB (Glia Maturation Factor Beta)
216575GMFB (Glia Maturation Factor beta, GMF-beta)
RC218-18GMF beta, Glia Maturation Factor beta, human
P1357-.5Recombinant Murine Glia Maturation Factor beta
MBS144221-01Recombinant Mouse Glia Maturation Factor Beta

Popular Products