Products for Research Use Only
RegisterLogin

RecombinantCINC-2α/CXCL3, Rat

CAT: 0013-GTR18990444-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990444-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as MIP2β (macrophage inflammatory protein 2 beta), or DCIP1 (dendritic cell inflammatory protein1) in mouse, CINC-2 (cytokineinduced neutrophil attractant 2) in rat, or GROγ (growthregulated oncogene gamma) in human. CXCL3 controls migration and adhesion of monocytes and mediates its effects on target cells by interacting with the cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates cerebellar granule neuron precursors toward the internal layers of the cerebellum during cerebellum morphogenesis. CXCL3 is a potential target for medulloblastoma therapy. CXCL3 is regulated transcriptionally by BTG2.Recombinant Rat CINC-2α/CXCL3 produced in CHO cells is a polypeptide chain containing 68 amino acids. A fully biologically active molecule, rrCINC-2α/CXCL3 has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Name Alternative
Growth Regulated Protein/Melanoma Growth Stimulatory Activity (MGSA γ), CXCL3, GRO gamma, CINC‐2, DCIP‐1, GRO3
Source
CHO
Field of Research
Immunology & Inflammation
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
The EC50 value of rat CINC‐2α/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/rCXCR2 cells (human G15 and ratCXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/ml.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
7.6 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Rat CINC-2α/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat CINC-2α/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS

Related Products

CatalogName
GTR19340710-01CXCL3 siRNA (Rat)
GTR18799800Rat CXCL3 ELISA Kit
GTR18821193Rat CXCL3 ELISA Kit
GTR18818211-01Rat CXCL3 ELISA Kit
GTR18838737Rat CXCL3 ELISA Kit
GTR18881561-01Rat CXCL3 protein (Active)
GTR18881560-01Rat CXCL3 protein (Active)
GTR18234925-01CXCL3 Antibody
GTR18059764CXCL3 Antibody
GTR17935197CXCL3 Antibody

Alternative Products

CatalogName
BK0189RecombinantCINC-2α/CXCL3,Rat
BK0189-01RecombinantCINC-2α/CXCL3, Rat
CSB-CL006249HUCXCL3
RECXP-0302Recombinant Rat CXCL3/CINC-2β
RECXP-0301Recombinant Rat CXCL3/CINC-2α
P6866-10μgRecombinant Rat CINC-2β/CXCL3
P6861-500μgRecombinant Rat CINC-2α/CXCL3
RC352-14BCXCL3, CINC-2 beta, rat
387975CXCL3 discontinued
MBS7123726-01CXCL3 Antibody

Popular Products