Products for Research Use Only
RegisterLogin

Human CD69 Protein

CAT: 0013-GTR18988767-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18988767-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Human CD69 Protein spans the amino acid sequence from region 62-199aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Name Alternative
(Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)
UniProt
Q07108
Expression Region
62-199aa
Tag
N-terminal 6xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody, the EC50 is 23.17-26.04 ng/mL.
Form
Liquid or Lyophilized powder
Molecular Weight
18.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
AA Sequence
GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Related Products

CatalogName
GTR18889344-01CD69 protein
GTR18907176CD69 Recombinant Protein
GTR19343674-01CD69 siRNA (Human)
GTR19032236-01Recombinant Human Early activation antigen CD69 (CD69), partial
GTR19149619-01Recombinant Human Early activation antigen CD69 (CD69), partial
GTR19123361-01Recombinant Human Early activation antigen CD69 (CD69), partial
GTR18842841Human CD69/Early activation antigen CD69 ELISA Kit
GTR18622967-01Anti-human CD69 (Genefrontier patent Anti-CD69 Biosimilar)
GTR18716471-01FITC human CD69 Antibody
GTR18716205-01PE human CD69 Antibody

Alternative Products

CatalogName
IT-300-051p-01Human CD69 Protein
abx656584-01Human Early Activation Antigen CD69 (CD69) Protein
PROTQ07108-01Human CD69 Recombinant Protein
MBS8304948-01Recombinant Human CD69 Protein
P1639-20Human CellExp™ CD69 Protein
TP727752CD69 Human Recombinant Protein
MBS2902232Human CD69 / Early Activation Antigen CD69 Recombinant Protein
BLT-00511P-01Human CD69 (Early Activation Antigen Cd69) - Recombinant Protein
MBS139083-01Human CD69 Protein Lysate
abx658189-01Rat CD69 (CD69) Protein

Popular Products