Products for Research Use Only
RegisterLogin

Fish GH Protein

CAT: 0013-GTR18985297-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18985297-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of fish GH protein
Product Name Alternative
GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.
Source
Escherichia Coli
Purity
Greater than 95.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) in 0.4% NaHCO3 or water adjusted to pH 8-9, not less than 100μg/ml and not more than 3mg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.
Storage Conditions
Stability: Lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3. Adjusted to pH-8.
AA Sequence
AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL

Related Products

CatalogName
GTR18851225-01Fish Growth hormone (GH) ELISA Kit
GTR18886635-01Gallus GH protein
GTR18985305-01Bovine GH Protein
GTR18985299-01Porcine GH Protein
GTR18985298-01Zebrafish GH Protein
GTR18985314-01Human GH Protein
GTR18985308-01Human GH Protein
GTR18985306-01Sheep GH Protein
GTR18883709-01Virus gH protein
GTR18881252-01Human gH protein

Alternative Products

CatalogName
abx263175-01Fish Leptin (LEP) Protein
QY-E160093Fish protein kinase C (PKC)
abx261785-01Fish Prolactin Soluble Receptor Protein
MBS037063Fish Ras Protein ELISA Kit
MBS033570Fish Placental Protein ELISA Kit
GTR14672856Fish Protein FAM83H ELISA kit
PX-P1125-100Zebra fish MCM5Nter Recombinant Protein
QY-E160079Fish C-Reactive Protein (CRP)
MBS005937Fish Translocator Protein ELISA Kit
MBS024961Fish Rhoa Protein ELISA Kit

Popular Products