Products for Research Use Only
RegisterLogin

Mouse IL 19 Protein

CAT: 0013-GTR18984986-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18984986-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of mouse IL 19 protein
Product Name Alternative
Interleukin-19, IL-19, Il19.
Source
Escherichia Coli
Purity
Greater than 95.0% as determined by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5.
AA Sequence
MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Related Products

CatalogName
GTR18889105-01Human IL-19 protein
GTR18911677-01IL-19 Recombinant Protein
GTR18907124-01Human IL-19 protein
GTR18984987-01Human IL 19 Protein
GTR18868121-01Mouse Interleukin 19 (IL-19) ELISA Kit
GTR18859115-01Mouse Interleukin 19 (IL-19) ELISA Kit
GTR18814886-01Mouse IL-19 (Interleukin-19) ELISA Kit
GTR18821210Mouse IL-19 ELISA Kit
GTR18895223-01Recombinant IL-19 (Interleukin-19), Mouse, Animal-Free
GTR18090518Mouse Monoclonal human IL-19 Antibody

Alternative Products

CatalogName
P516947Protein (Mouse)
E40MOP1990Mouse Protein
AR01002PU-NMouse IgE Mouse Protein
RA048Mouse IgM Mouse Protein
ARP2795-01Recombinant Mouse Leptin Mouse Protein
AR01007PU-NMouse IgM (kappa) Mouse Protein
RA073Normal Mouse IgG Mouse Protein
abx068732-01Mouse Protein C (PROC) Protein

Popular Products