Products for Research Use Only
RegisterLogin

Human MIF (Active) Protein

CAT: 0013-GTR18984845-01Size: 3 x 2 ugDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18984845-01Size:3 x 2 ug
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of human MIF (Active) protein
Product Name Alternative
Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
Source
Escherichia Coli
Field of Research
Immunology & Inflammation
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml.
Storage Conditions
Stability: Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
AA Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Related Products

CatalogName
GTR19008863-01MIF (MIF Human) protein
GTR18885319-01Human MIF protein
GTR18884985-01Human MIF protein
GTR19145075-01Human MIF Protein
GTR18984847-01Human MIF Protein
GTR18887358-01Human MIF protein
GTR18885282-01Human MIF protein
GTR18886839-01Human MIF protein
GTR18884435-01Human MIF protein
GTR18905663-01Human MIF protein

Alternative Products

CatalogName
GWB-A1590AAkt2 active, Active Human Recombinant Protein
RPU60405-01Human Neprilysin, Active Protein
B2013593Human Met Protein Active
B2013495ZAP70 Active Protein Human
B2014241Human Lyn Protein Active
B2014221Human FGFR3 Protein Active
B2014187Human JAK3 Protein Active
B2014033Human CK1 ε Protein Active
B2023362Blk Protein, Active, Human
B2014280Human IRAK4 Protein Active

Popular Products