Products for Research Use Only
RegisterLogin

Human NRG1 Protein

CAT: 0013-GTR18984815-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18984815-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of Human NRG1 protein
Product Name Alternative
Neuregulin-1, NRG1, GGF, HGL, HRGA, NDF, SMDF, HRG, ARIA, GGF2, HRG1.
Source
Escherichia Coli
Field of Research
Cancer Biology
Purity
Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 5ng/ml, corresponding to a specific activity of > 2.0 x 105 U/mg.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized NRG1 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
AA Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Related Products

CatalogName
GTR18984812-01Human NRG1 A Protein
GTR18984814-01Human NRG1 B1 Protein
GTR19145280-01Human NRG1 Beta1 Protein
GTR19304177-01NRG1 siRNA (Human)
GTR18893932-01Recombinant Human NRG1
GTR18826282-01Human NRG1 ELISA Kit
GTR18154088-01NRG1 Antibody
GTR18120582NRG1 Antibody
GTR17937460NRG1 Antibody
GTR18578735NRG1 Antibody

Alternative Products

CatalogName
P527192NRG1 Protein (Native, Human)
CRP2026-01Recombinant Human NRG1 Protein
PRP1954-01Human NRG1 Beta1 Protein
MBS8427636-01Human NRG1 Protein Lysate
PPT-14290Human NRG1 Recombinant Protein
IHUNRG1PLLY20UGHuman NRG1 Protein Lysate 20ug
NBP2-35099-500ugRecombinant Human NRG1 beta2 Protein
abx263488-01Human Neuregulin 1 (NRG1) Protein
KMPH4322Human NRG1 Protein, Fc Tag
KMPH2240Human NRG1 Protein, His Tag

Popular Products