Products for Research Use Only

Human PRL R Protein

CAT: 0013-GTR18984714-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18984714-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of human PRL R protein
Product Name Alternative
PRL-R, hPRLrI.
Source
Escherichia Coli
Purity
Greater than 97.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.
Bioactivity
Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Form
Sterile filtered white lyophilized powder.
Solubility
It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100μg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles as they cause oligomerization of the protein
Notes
For research use only.
Applications Notes
Protein content: UV spectroscopy at 280 nm using the absorbency value of 2.63 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics)
Preservative
The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3.
AA Sequence
AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW

Popular Products