Products for Research Use Only

Human TFF1 Protein

CAT: 0013-GTR18984626-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18984626-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of human TFF1 protein
Product Name Alternative
TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.
Source
Escherichia Coli
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10μg/ml, corresponding to a specific activity of >100 IU/mg.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized TFF1 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
The Human TFF1 protein was lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl.
AA Sequence
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF