Products for Research Use Only
RegisterLogin

Human Eotaxin 2 Protein

CAT: 0013-GTR18984879-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18984879-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of human Eotaxin 2 protein
Product Name Alternative
C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.
Source
Escherichia Coli
Field of Research
Immunology & Inflammation
Purity
Greater than 97.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Chemokines
Preservative
The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.
AA Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA

Related Products

CatalogName
GTR18984657-01Eotaxin 2 Protein
GTR18911587-01Eotaxin-2 Recombinant Protein
GTR18888933-01Mouse Eotaxin 2 protein
GTR18984768-01Mouse Eotaxin 2 Protein
GTR18985434-01Human Eotaxin Protein
GTR18911551-01Eotaxin-2 Recombinant Protein
GTR18888292-01Rat Eotaxin 2 protein
GTR18985101-01Eotaxin Protein
GTR18984546-01Human Eotaxin 3 Protein
GTR18985323-01Human Eotaxin (His) Protein

Alternative Products

CatalogName
P513759CCL11; Eotaxin Protein (Human)
abx261552-01Human Eotaxin (CCL11) Protein
UA040163-01Eotaxin/CCL11 Protein, Human
MBS9422889-01Recombinant Human Eotaxin protein (CCL11)
NBP2-34976-100ugRecombinant Human CCL11/Eotaxin Protein
P514908Eotaxin-3; CCL26 Protein (Human)
PROTP51671-500ugHuman CCL11/Eotaxin Recombinant Protein
TMPJ-01001-01Eotaxin/CCL11 Protein, Human, Recombinant
MBS2901550Human CCL11 / Eotaxin Recombinant Protein
BLT-03991P-01Human CCL11 (Eotaxin) - Recombinant Protein

Popular Products