Products for Research Use Only
RegisterLogin

RecombinantOTOR, Human

CAT: 0013-GTR18990260-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990260-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the melanoma-inhibiting activity gene family. Members of this family which also includes MIA, MIA2, and TANGO share a SRC homology-3 (SH3) -like domain. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function. OTOR is highly homologous to MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), which is a cartilage-specific protein that is also expressed in malignant melanoma cells. The 111 amino acid mature human otoraplin contains 1 SH3 domain (46-107 amino acids) and a Tyr at position 50 that is reportedly sulfated. Otoraplin takes part in the initiation of periotic mesenchyme chondrogenesis. Recombinant human Otoraplin (OTOR) produced in CHO cells is a single non-glycosylated polypeptide chain containing 111 amino acids. A fully biologically active molecule, rhOTOR has a molecular mass of 14-15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Name Alternative
Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1
Source
CHO
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
Data Not Available.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
14-15 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant human Otoraplin (OTOR) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Otoraplin (OTOR) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENG AGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

Related Products

CatalogName
GTR18777889-01Human Human CYP19A1 Antibody
GTR18882498-01Human human Septin-7 protein
GTR18880605-01Human Human Septin-7 protein
GTR18834069-01Human Human Macrosialin ELISA Kit
GTR19008890-01Human BDNF (BDNF Human) protein
GTR18698434-01HuMax-IL8 Human Monoclonal Antibody
GTR18698323-01HuMax-IL15 Human Monoclonal Antibody
GTR17702017Rabbit Human Sirt1 Protein (Human) Antibody
GTR18877893Human Human IgG3 Lambda G3M (G)
GTR18895534-01Human HspH1

Alternative Products

CatalogName
BK0280RecombinantOTOR,Human
BK0150-01RecombinantOTOR, Human
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
PT_75080-01Adiponectin Human (Acrp30 Human)
PT_42362-01Urokinase Human (Urokinase Human)
PT_42243-01Human Thrombin (Thrombin Human)
PT_41408-01Leuprolide Human (Leuprorelin Human)

Popular Products