Recombinant Mouse Interleukin-4 (Il4) (Active)
CAT:
399-CSB-AP004831MO-02
Size:
500 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Mouse Interleukin-4 (Il4) (Active)
- CAS Number: 9000-83-3
- Gene Name: Il4
- UniProt: P07750
- Expression Region: 21-140aa
- Organism: Mus musculus
- Target Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
- Tag: C-terminal 6xHis-tagged
- Source: Mammalian cell
- Field of Research: Immunology
- Assay Type: Active Protein & In Stock Protein
- Relevance: Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. IL-4 is produced by mast cells, T cells, and bone marrow stromal cells. IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergic response.
- Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
- Purity: Greater than 95% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.035 ng/ml.
- Length: Full Length of Mature Protein
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Function: Participates in at least several B-cell activation processes as well as of other cell types
- Molecular Weight: 14.6 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.