Recombinant Mouse P2Y purinoceptor 1 (P2ry1)

• Product Name Alternative:

  (P2Y1) (ADP receptor) (Purinergic receptor)

• Abbreviation:

  Recombinant Mouse P2ry1 protein

• Gene Name:

  P2ry1

• UniProt:

  P49650

• Expression Region:

  1-373aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVVVAISPILFYSGTGTRKNKTVTCYDTTSNDYLRSYFIYSMCTTVAMFCIPLVLILGCYGLIVKALIYNDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEEMTLNILSEFKQNGDTSL

• Tag:

  N-terminal 10xHis-tagged

• Type:

  CF Transmembrane Protein & Developed Protein

• Source:

  In vitro E.coli expression system

• Field of Research:

  Neuroscience

• Relevance:

  Receptor for extracellular adenine nucleotides such as ADP. In platelets, binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and ultimately platelet aggregation.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  48.3 kDa

• References & Citations:

  "Defective platelet aggregation and increased resistance to thrombosis in purinergic P2Y (1) receptor-null mice." Leon C., Hechler B., Freund M., Eckly A., Vial C., Ohlmann P., Dierich A., LeMeur M., Cazenave J.-P., Gachet C. J. Clin. Invest. 104:1731-1737 (1999)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length