Recombinant Bombyx mori General odorant-binding protein 1

• UniProt:

  P34171

• Expression Region:

  19-164aa

• Organism:

  Bombyx mori (Silk moth)

• Target Sequence:

  DVYVMKDVTLGFGQALEQCREESQLTEEKMEEFFHFWNDDFKFEHRELGCAIQCMSRHFNLLTDSSRMHHENTDKFIKSFPNGEILSQKMIDMIHTCEKTFDSEPDHCWRILRVAECFKDACNKSGLAPSMELILAEFIMESEADK

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Source:

  E.coli

• Field of Research:

  Others

• Assay Type:

  Developed Protein

• Relevance:

  Present in the aqueous fluid surrounding olfactory sensory dendrites and are thought to aid in the capture and transport of hydrophobic odorants into and through this fluid.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Full Length of Mature Protein

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  24.6 kDa

• References & Citations:

  "Binding proteins from the antennae of Bombyx mori." Krieger J., von Nickisch-Rosenegk E., Mameli M., Pelosi P., Breer H. Insect Biochem. Mol. Biol. 26:297-307 (1996)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

• CAS Number:

  9000-83-3