Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG)

CAT:
399-CSB-EP365162ENV-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) - image 1

Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG)

  • Product Name Alternative:

    (3-ketoacyl-acyl carrier protein reductase) (Beta-Ketoacyl-acyl carrier protein reductase) (Beta-ketoacyl-ACP reductase)
  • Abbreviation:

    Recombinant E.coli fabG protein
  • Gene Name:

    FabG
  • UniProt:

    P0AEK2
  • Expression Region:

    1-244aa
  • Organism:

    Escherichia coli (strain K12)
  • Target Sequence:

    MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Signal Transduction
  • Relevance:

    Catalyzes the NADPH-dependent reduction of beta-ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cycle of fatty acid biosynthesis.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    33.0 kDa
  • References & Citations:

    "A second-generation protein-protein interaction network of Helicobacter pylori." Hauser R., Ceol A., Rajagopala S.V., Mosca R., Siszler G., Wermke N., Sikorski P., Schwarz F., Schick M., Wuchty S., Aloy P., Uetz P. Mol Cell Proteomics 13:1318-1329 (2014) .
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length