SAA2, Human (His)

• UNSPSC Description:

  SAA2 Protein, Human (His) is the recombinant human-derived SAA2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SAA2 Protein, Human (His) is 104 a.a., with molecular weight of ~14.0 kDa.

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/saa2-protein-human-his.html

• Purity:

  97.00

• Smiles:

  RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY

• Molecular Weight:

  Approximately 14.0 kDa

• Shipping Conditions:

  Blue Ice

• Storage Conditions:

  Stored at -20°C for 2 years