Products for Research Use Only

Human IRF1 protein

CAT: 0013-GTR18886442-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18886442-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Human IRF1 protein spans the amino acid sequence from region 1-325aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Name Alternative
Interferon regulatory factor 1, Interferon regulatory factor 1 isoform +I9, Interferon regulatory factor 1 isoform d78, Interferon regulatory factor 1 isoform delta4, Interferon regulatory factor 1 isoform delta7, IRF 1, IRF-1, IRF1, IRF1_HUMAN, MAR, MAR1
UniProt
P10914
Expression Region
1-325aa
Tag
N-terminal 10xHis-tagged and C-terminal GST-tagged
Source
Baculovirus
Origin
Homo sapiens (Human)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
65.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP

Popular Products