Env protein

CAT: 0013-GTR18886091-02Size: 100 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18886091-02Size:100 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This env protein spans the amino acid sequence from region 32-470aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Name Alternative

Env polyprotein

UniProt

P03386

Expression Region

32-470aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

AKV murine leukemia virus (AKR (endogenous) murine leukemia virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTLGNSPHQVFNLTWEVTNGDRETVWAITGNHPLWTWWPDLTPDLCMLALHGPSYWGLEYRAPFSPPPGPPCCSGSSDSTPGCSRDCEEPLTSYTPRCNTAWNRLKLSKVTHAHNGGFYVCPGPHRPRWARSCGGPESFYCASWGCETTGRASWKPSSSWDYITVSNNLTSDQATPVCKGNEWCNSLTIRFTSFGKQATSWVTGHWWGLRLYVSGHDPGLIFGIRLKITDSGPRVPIGPNPVLSDRRPPSRPRPTRSPPPSNSTPTETPLTLPEPPPAGVENRLLNLVKGAYQALNLTSPDKTQECWLCLVSGPPYYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCIGAVPKTHQVLCNTTQKTSDGSYYLAAPTGTTWACSTGLTPCISTTILDLTTDYCVLVELWPRVTYHSPSYVYHQFERRAKYKR

UniProtKB · P03386

Envelope glycoprotein

ENV_MLVAV · AKV murine leukemia virus

View on UniProt ↗

Primary accession: P03386
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: env
Protein existence: 1: Evidence at protein level
Organism: AKV murine leukemia virus (AKR (endogenous) murine leukemia virus)
Taxonomy ID: 11791
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: —

Protein keywords

PTM

Cleavage on pair of basic residuesDisulfide bondGlycoproteinLipoproteinPalmitate

Domain

Coiled coilSignalTransmembraneTransmembrane helix

Biological process

Fusion of virus membrane with host cell membraneFusion of virus membrane with host membraneHost-virus interactionViral attachment to host cellViral penetration into host cytoplasmVirus entry into host cell

Cellular component

Host cell membraneHost membraneMembraneViral envelope proteinVirion

Ligand

Metal-bindingZinc

Related Products

Catalog	Name
GTR18187427	Env Antibody
GTR18006107	Env Antibody
GTR18006105	Env Antibody
GTR18006100	Env Antibody
GTR18006094	Env Antibody
GTR18006091	Env Antibody
GTR18006084	Env Antibody
GTR18006081	Env Antibody
GTR18006078	Env Antibody
GTR18006077	Env Antibody

Alternative Products

Catalog	Name
30R-1304	Protein A protein
abx262181-01	Protein G Protein
abx262179-01	Protein A / G Protein
abx061407	PLDH Protein Protein
NBP2-34964-100mg	Recombinant Protein A Protein
NBP1-97288	Protein A Native Protein
abx262993-01	Protein L Protein
abx262074-01	Centromere Protein-A Protein
OPPA01758-1MG	Protein A/G Protein
OPSB02902-1ML	Protein A Protein : HRP