Ppk2 protein

CAT: 0013-GTR18886039-02Size: 100 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18886039-02Size:100 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This ppk2 protein spans the amino acid sequence from region 140-343aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Name Alternative

ATP-polyphosphate phosphotransferase 2 Polyphosphoric acid kinase 2

UniProt

O68984

Expression Region

140-343aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EQQQLLQHYFRKEVFPVLTPLAFDTGHPFPFMSNLSLNLAIELEDEESGAIKFARVKVPGILSRIIRLDQIEGLGFDDGRIRLLWLEDLVEHNLDQLFPKMRILQCHPFRIIRDADIEIEEDEAGDLLESIEQGVRSRRYGKVVRLDINPDMPHSIRSLLVKNLETYERNVYEIGGVLGMSALMELLKIDRPDLKDELFVPNNP

UniProtKB · O68984

Polyphosphate kinase 2

PPK12_CHLTE · Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

View on UniProt ↗

Primary accession: O68984
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: ppk2
Protein existence: 3: Inferred from homology
Organism: Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum)
Taxonomy ID: 194439
Alternative names: —
EC number: 2.7.4.1
Processing: —
Secondary accessions: —

Protein keywords

Ligand

ATP-bindingMagnesiumMetal-bindingNucleotide-binding

Molecular function

KinaseTransferase

PTM

Phosphoprotein

Technical term

Reference proteome

Related Products

Catalog	Name
GTR18018528	Ppk2 Antibody
GTR18026719	Ppk2 Antibody
GTR18886619-01	E. coli ppk protein
GTR18886719-01	E. coli ppk protein
GTR18018891	Ppk23 Antibody
GTR18018495	Ppk9 Antibody
GTR18018477	Ppk24 Antibody
GTR18018476	Ppk1 Antibody
GTR18018902	Ppk29 Antibody
GTR18018508	Ppk21 Antibody

Alternative Products

Catalog	Name
MBS1387838	Recombinant Schizosaccharomyces pombe Protein kinase domain-containing protein ppk2 (ppk2), partial
TMPH-00398-01	PPK2 Protein, Chlorobium tepidum, Recombinant (His & Myc)
PHY3410A	PPK2 Antibody
RPC27706-01	Recombinant Chlorobium tepidum Polyphosphate kinase 2 (ppk2), partial
MBS7188970	Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) PPK2 Polyclonal Antibody
MBS7182024	Rabbit anti-Chlorobaculum tepidum (strain 49652/DSM 12025/NBRC 103806/TLS)(Chlorobium tepidum) ppk2 Polyclonal Antibody
30R-1304	Protein A protein
abx262993-01	Protein L Protein
NBP2-35001	Recombinant Protein A Protein
abx260044-01	Protein G Protein