E. coli Escherichia phage lambda Capsid decoration protein

CAT: 0013-GTR18885849-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18885849-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This E. coli Escherichia phage lambda Capsid decoration protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Name Alternative

Auxiliary protein D Gene product D Major capsid protein D

UniProt

P03712

Expression Region

1-110aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia phage lambda (Bacteriophage lambda)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV

UniProtKB · P03712

Capsid decoration protein

DECO_LAMBD · Escherichia phage lambda

View on UniProt ↗

Primary accession: P03712
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: D
Protein existence: 1: Evidence at protein level
Organism: Escherichia phage lambda (Bacteriophage lambda)
Taxonomy ID: 2681611
Alternative names: —
EC number: —
Processing: —
Secondary accessions: —

Protein keywords

Technical term

3D-structureDirect protein sequencingReference proteome

Cellular component

Capsid decoration proteinCapsid proteinHost cytoplasmVirion

Developmental stage

Late protein

Biological process

Viral capsid assemblyViral release from host cell

Related Products

Catalog	Name
GTR18893593-01	Recombinant Escherichia phage lambda Capsid decoration protein (D)
GTR18988918-01	Escherichia phage lambda Integrase Protein
GTR19123562-01	Recombinant Escherichia phage MS2 Capsid protein
GTR19066117-01	Recombinant Escherichia phage MS2 Capsid protein
GTR19149499-01	Recombinant Escherichia phage T7 Major capsid protein
GTR19033410-01	Recombinant Escherichia phage lambda Antiholin (S), partial
GTR19338765	DNA (Lambda Phage)
GTR19338764	DNA (Lambda Phage)
GTR19146878-01	Recombinant Escherichia phage lambda bet Protein, N-His
GTR19112005-01	Recombinant Escherichia coli Phage shock protein G (pspG)

Alternative Products

Catalog	Name
abx345757-01	Escherichia Phage Lambda Capsid Decoration Protein (Lambda Phage D) Antibody
TMPH-00754-01	Capsid decoration Protein, Escherichia phage lambda, Recombinant (GST)
MBS9018574-01	Recombinant Escherichia phage lambda Capsid decoration protein (D)
CSB-EP361132FSF1e3-01	Recombinant Escherichia phage lambda Capsid decoration protein (D), partial
583893-01	Capsid Decoration Protein, Recombinant, Escherichia phage lambda, aa1-56, GST-Tag
583892-01	Capsid Decoration Protein, Recombinant, Escherichia phage lambda, aa1-110, His-Tag
583894-01	Capsid Decoration Protein, Recombinant, Escherichia phage lambda, aa1-56, His-KSI-Tag
583891-01	Capsid Decoration Protein, Recombinant, Escherichia phage lambda, aa1-110, His-KSI-Tag
MBS1165271-01	Recombinant Enterobacteria phage lambda Minor capsid protein C (C)
MBS1358318	Recombinant Reovirus type 2 Inner capsid protein lambda-1, partial