Products for Research Use Only
RegisterLogin

Human MYD88 protein

CAT: 0013-GTR18884477-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18884477-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Human MYD88 protein spans the amino acid sequence from region 1-296aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Name Alternative
Mutant myeloid differentiation primary response 88, MYD 88, Myd88, MYD88_HUMAN, MYD88D, Myeloid differentiation marker 88, Myeloid differentiation primary response 88, Myeloid differentiation primary response gene (88), Myeloid differentiation primary response gene 88, Myeloid differentiation primary response gene, Myeloid differentiation primary response protein MyD88, OTTHUMP00000161718, OTTHUMP00000208595, OTTHUMP00000209058, OTTHUMP00000209059, OTTHUMP00000209060
UniProt
Q99836
Expression Region
1-296aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
37.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Related Products

CatalogName
GTR19320352-01Human MyD88
GTR19305869-01MYD88 siRNA (Human)
GTR18863750-01Human MYD88 (Myeloid differentiation primary response protein MyD88) Quick ELISA Kit
GTR18907265MyD88 Fragment Recombinant Protein
GTR18826589-01Human MyD88 ELISA Kit
GTR18838965Human MyD88 ELISA Kit
GTR18801259-01Human MYD88 ELISA Kit
GTR18801024Human MyD88 ELISA Kit
GTR18820814Human MYD88 ELISA Kit
GTR18799542Human MyD88 ELISA Kit

Alternative Products

CatalogName
PROTQ99836-01Human MyD88 Recombinant Protein
MBS1561406-01Recombinant Human MYD88 protein
abx654429-01Human Myeloid Differentiation Primary Response Protein MyD88 (MYD88) Protein
MBS8415675-01Human MYD88 Protein Lysate
RP020464MyD88 Recombinant Protein (Human)
R1707hHuman MYD88 / Myeloid differentiation primary response protein MyD88 Recombinant Protein
BLT-01933P-01Human MYD88 (Myeloid Differentiation Primary Response Protein Myd88) - Recombinant Protein
RPC26047-01Recombinant Human Myeloid differentiation primary response protein MyD88 (MYD88)
TP302253MYD88 (NM_002468) Human Recombinant Protein
IHUMYD88PLLY20UGHuman MYD88 Protein Lysate 20ug

Popular Products