E. coli relB protein

CAT: 0013-GTR18884256-02Size: 100 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18884256-02Size:100 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This E. coli relB protein spans the amino acid sequence from region 1-79aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Name Alternative

RelB, b1564, JW1556, Antitoxin RelB

UniProt

P0C079

Expression Region

1-79aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL

UniProtKB · P0C079

Antitoxin RelB

RELB_ECOLI · Escherichia coli (strain K12)

View on UniProt ↗

Primary accession: P0C079
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: relB
Protein existence: 1: Evidence at protein level
Organism: Escherichia coli (strain K12)
Taxonomy ID: 83333
Alternative names: —
EC number: —
Processing: —
Secondary accessions: P07007

Protein keywords

Technical term

3D-structureReference proteome

Molecular function

DNA-bindingRepressor

Biological process

Stress responseToxin-antitoxin systemTranscriptionTranscription regulation

Related Products

Catalog	Name
GTR18886159-01	E. coli FimF41a protein
GTR18886129-01	E. coli rpoS protein
GTR18885856-01	E. coli oppA protein
GTR18885723-01	E. coli glmU protein
GTR18887564-01	E. coli hdhA protein
GTR18887559-01	E. coli ampC protein
GTR18885257-01	E. coli bamA protein
GTR18886800-01	E. coli gyrA protein
GTR18886797-01	E. coli hns protein
GTR18886633-01	E. coli cysP protein

Alternative Products

Catalog	Name
TMPH-00579-01	Antitoxin RelB Protein, E. coli, Recombinant (His & Myc)
MBS1078091-01	Recombinant Escherichia coli Antitoxin RelB (relB)
RPC28237-01	Recombinant E. coli Antitoxin RelB (relB)
R1732m	Mouse Relb / Transcription factor RelB Recombinant Protein
OPCD06662-50UG	RELB Recombinant Protein
MBS2902972	Human RELB / Transcription Factor RelB Recombinant Protein
OCOA12073-20UG	RELB Protein Lysate
517805-01	Antitoxin RelB, Recombinant, E. coli, aa1-79, His-Tag, Myc-Tag (RelB)
R1732c	Chicken RELB / Transcription factor RelB homolog Recombinant Protein
MBS8418468-01	Human RELB Protein Lysate