Human TGF beta 1 protein

CAT: 0013-GTR18884468-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18884468-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Human TGF beta 1 protein spans the amino acid sequence from region 281-390aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Name Alternative

Cartilage-inducing factor, CED, Differentiation inhibiting factor, DPD1, LAP, Latency-associated peptide, Prepro transforming growth factor beta 1, TGF beta 1, TGF beta, TGF beta 1 protein, TGF-beta 1 protein, TGF-beta-1, TGF-beta-5, TGF-beta1, TGFB, Tgfb-1, tgfb1, TGFB1_HUMAN, TGFbeta, TGFbeta1, Transforming Growth Factor b1, Transforming Growth Factor beta 1, Transforming growth factor beta 1a, transforming growth factor beta-1, transforming growth factor, beta 1, Transforming Growth Factor-?

UniProt

P01137

Expression Region

281-390aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

UniProtKB · P01137

Transforming growth factor beta-1 proprotein

TGFB1_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P01137
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: TGFB1
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: A8K792, Q9UCG4

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

PTM

Cleavage on pair of basic residuesDisulfide bondGlycoprotein

Disease

Disease variant

Cellular component

Extracellular matrixSecreted

Molecular function

Growth factorMitogen

Domain

Signal

Related Products

Catalog	Name
GTR18878205-01	Human LAP (TGF-beta 1) Protein
GTR18911831-01	TGF beta 1 Recombinant Protein
GTR18887597-01	Rat TGF beta 1 protein
GTR18885433-01	Mouse TGF beta 1 protein
GTR18911765-01	TGF beta 1 Recombinant Protein
GTR18910136	TGF beta 1 Recombinant Protein
GTR18907494	TGF beta 1 Recombinant Protein
GTR18887624-01	Rat TGF beta 1 protein
GTR18883091-01	Rat TGF beta 1 protein
GTR18884283-01	Rat TGF beta 1 protein

Alternative Products

Catalog	Name
MBS189697-01	Human TNF beta Protein
abx060120	Human beta HCG Protein
E2PD201141	Human beta-NGF Protein
MBS9718672-01	Human TNF-beta Protein
MBS9719443-01	Human TGF-beta protein
MBS9718689-01	Human IFN-beta Protein
abx657948-01	Human Beta-Hexosaminidase Subunit Beta (HEXB) Protein
R1151h	Human Beta-APP42 / Beta-amyloid protein 42 Recombinant Protein
CD00952-01	Recombinant Human SDF-1 Beta/CXCL12 Beta protein
HCG15-N-100	Purified Human Chorionic Gonadotropin beta (HCG, beta) protein