Products for Research Use Only

Human PRLR protein

CAT: 0013-GTR18883382-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18883382-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Human PRLR protein spans the amino acid sequence from region 25-622aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Name Alternative
AI987712, CLONE SPM213, CPRLP, Delta 4-delta 7/11 truncated prolactin receptor , Delta 4-SF1b truncated prolactin receptor , HPRL, hPRL receptor, hPRLrI, Lactogen receptor, MFAB, MGC105486, OPR, OTTHUMP00000115998 , Pr-1, Pr-3, PRL R, PRL-R, PRLR, Prlr-rs1, PRLR_HUMAN, Prolactin receptor a, Prolactin receptor, Prolactin receptor delta 7/11 , RATPRLR, Secreted prolactin binding protein , Truncated testis-specific box 1-C prolactin receptor , wu, fj65c07
UniProt
P16471
Expression Region
25-622aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
In vitro E.coli expression system
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
71.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 25-622aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH

Popular Products