Products for Research Use Only
RegisterLogin

Reptile subunit alpha protein

CAT: 0013-GTR18881872-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18881872-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Reptile subunit alpha protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Name Alternative
Aggretin alpha chain Rhodoaggretin subunit alpha
UniProt
Q9I841
Expression Region
1-136aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
Field of Research
Epigenetics
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
31.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Related Products

CatalogName
GTR18881449-01Reptile Snaclec rhodocytin subunit alpha protein
GTR18881451-01Reptile Snaclec rhodocytin subunit beta protein
GTR18883912-01Reptile Naja kaouthia Alpha-cobratoxin protein
GTR18882914-01Reptile EURM2 protein
GTR18882712-01Reptile Calloselasma rhodostoma Rhodocytin subunit beta protein
GTR18886629-01Reptile TLF1 protein
GTR18882915-01Reptile EURM2 protein
GTR18880890-01Reptile Kunitz-type neurotoxin MitTx-alpha protein
GTR18883932-01Reptile Bungarus multicinctus Alpha-bungarotoxin isoform A31 protein
GTR18881053-01Reptile Disintegrin halysin protein

Alternative Products

CatalogName
478382COPA (Coatomer Subunit Alpha, Coatomer Protein Complex, Subunit Alpha)
MBS7043359-01Translocon-associated protein subunit alpha
abx262533-01Hemoglobin subunit alpha 2 Protein
E55A14547Gs protein, alpha subunit Antibody
315695FNTA (FTase-alpha, Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha, CAAX farnesyltransferase subunit alpha, Ras proteins prenyltransferase subunit alpha, Type I protein geranyl-geranyltransferase subunit alpha)
MBS6009549-01FNTA (Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit alpha, CAAX Farnesyltransferase Subunit alpha, FTase-alpha, Ras Proteins Prenyltransferase Subunit alpha, Type I Protein Geranyl-geranyltransferase Subunit alpha, GGTase-I-alpha)
MBS6400611-01FNTA (Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit alpha, CAAX Farnesyltransferase Subunit alpha, FTase-alpha, Ras Proteins Prenyltransferase Subunit alpha, Type I Protein Geranyl-geranyltransferase Subunit alpha, GGTase-I-alpha, M
137981FNTA (Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit alpha, CAAX Farnesyltransferase Subunit alpha, FTase-alpha, Ras Proteins Prenyltransferase Subunit alpha, Type I Protein Geranyl-geranyltransferase Subunit alpha, GGTase-I-alpha, MGC99680)
F0019-58X8FNTA (Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit alpha, CAAX Farnesyltransferase Subunit alpha, FTase-alpha, Ras Proteins Prenyltransferase Subunit alpha, Type I Protein Geranyl-geranyltransferase Subunit alpha, GGTase-I-alpha) discontinued
035706FNTA, NT (FNTA, Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha, CAAX farnesyltransferase subunit alpha, FTase-alpha, Ras proteins prenyltransferase subunit alpha, Type I protein geranyl-geranyltransferase subunit alpha)

Popular Products