Human F19A2 protein (Active)

CAT: 0013-GTR18881761-01Size: 5 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18881761-01Size:5 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Human F19A2 protein (Active) spans the amino acid sequence from region 31-131aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Name Alternative

Chemokine-like protein TAFA-2

UniProt

Q8N3H0

Expression Region

31-131aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDSPAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity is determined by its ability to enhance neurite outgrowth of E16E18 rat embryonic cortical neurons. rHuTAFA2, immobilized at 624 μg/mL on a 96 well plate, is able to significantly enhance neurite outgrowth.

Form

Lyophilized powder

Molecular Weight

11.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

UniProtKB · Q8N3H0

Chemokine-like protein TAFA-2

TAFA2_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: Q8N3H0
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: TAFA2
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: B3KVV4, Q4G0R9, Q68DK0, Q6GTX6

Protein keywords

Coding sequence diversity

Alternative splicing

Cellular component

CytoplasmNucleus

Technical term

Proteomics identificationReference proteome

Domain

Signal

Related Products

Catalog	Name
GTR18054504-01	F19A2 rabbit pAb Antibody
GTR18985459-01	Human Activin-A Active Protein
GTR18985452-01	Human Activin B Active Protein
GTR18985458-01	Human Activin-A Plant-Active Protein
GTR18988639-01	Human Active Protein
GTR19143947-01	Recombinant human Activin A protein (Active, CHO)
GTR18882246-01	Human CCL27 protein (Active)
GTR18882157-01	Human CCL14 protein (Active)
GTR18882146-01	Human CCL13 protein (Active)
GTR18882135-01	Human CCL11 protein (Active)

Alternative Products

Catalog	Name
GWB-A1590A	Akt2 active, Active Human Recombinant Protein
RPU60405-01	Human Neprilysin, Active Protein
RPU60438-01	Human Catalase, Active Protein
RPU60240-01	Human Kallistatin, Active Protein
AR03019PU-N	HSP60 (active) Human Protein
abx655607-01	Human Endostatin Protein (Active)
RPU60713-01	Human Tryptase, Active Protein
RPU60608-01	Human Cubilin, Active Protein
RPU60216-01	Human Granulysin, Active Protein
MBS355522-01	Human albumin Protein (Active)