Products for Research Use Only
RegisterLogin

Viral VMI2 protein (Active)

CAT: 0013-GTR18881694-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18881694-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Viral VMI2 protein (Active) spans the amino acid sequence from region 24-93aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Product Name Alternative
Viral macrophage inflammatory protein II Short name:vMIP-II vMIP-1B
UniProt
Q98157
Expression Region
24-93aa
Tag
Tag-Free
Source
E.Coli
Origin
Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus)
Field of Research
Infectious Disease & Virology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 97% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The specific activity is determined by the inhibitory effect on monocyte migration response to human MIP-1 alpha using a concentration range of 1.0μg-10.0μg/ml of viral MIP-2 will inhibit 25ng/ml of human MIP-1 alpha.
Form
Lyophilized powder
Molecular Weight
8.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4
AA Sequence
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTA

Related Products

CatalogName
GTR19025244-01Recombinant Human herpesvirus 8 type P protein (VMI2) (Active)
GTR18985459-01Human Activin-A Active Protein
GTR19283580Viral ADENOVIRUS protein
GTR18883493-01Viral Nucleoprotein protein
GTR18883482-01Viral Nucleoprotein protein
GTR18883465-01Viral Glycoprotein protein
GTR18883147-01Viral VP30 protein
GTR18882925-01Viral VACWR034 protein
GTR18882921-01Viral GPC protein
GTR18882875-01Viral GAG protein

Alternative Products

CatalogName
CSB-AP001611HKE-01Recombinant Human herpesvirus 8 type P Viral macrophage inflammatory protein 2 (VMI2), partial (Active)
MBS969279-01Recombinant Human herpesvirus 8 type P protein (VMI2) (Active)
RPC29140-01Recombinant Human herpesvirus 8 type P protein (VMI2), partial , Active Protein
RPU54923-01Human V-Myc Myelocytomatosis Viral Oncogene Homolog (MYC), Active Protein
220015LYN B, Active, Recombinant, Human (Lyn B, V-yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog, Lyn, Lck/Yes-related Novel Protein Tyrosine Kinase) discontinued
MBS635729-01Akt1, active (v-akt Mouse Thymoma Viral Oncogene Homolog 1, C-AKT, MGC99656, PKB, PRKBA, Protein kinase B, RAC, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha) Recombinant
137251Abl Kinase, Active, Recombinant, Human, His-Tag (ABL, Tyrosine-protein Kinase ABL1, Abelson Murine Leukemia Viral Oncogene Homolog 1, c-Abl, Proto-oncogene c-Abl, p150, ABL1, JTK7)
A1125-06Akt1, Active, Recombinant, Human, His-Tag (v-akt Mouse Thymoma Viral Oncogene Homolog 1, C-AKT, PKB, PRKBA, Protein kinase B, RAC, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha)
137250Abl Kinase Mutant, Active, Recombinant, Human (T334I), His-Tag (ABL, Tyrosine-protein Kinase ABL1, Abelson Murine Leukemia Viral Oncogene Homolog 1, c-Abl, Proto-oncogene c-Abl, p150, ABL1, JTK7)
A1125-01Akt1, Human, phosphorylated, active, Western Blot Positive Control (v-akt Mouse Thymoma Viral Oncogene Homolog 1, C-AKT, MGC99656, PKB, PRKBA, Protein kinase B, RAC, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha) Recombinant

Popular Products