Products for Research Use Only
RegisterLogin

Human CCL22 protein (Active)

CAT: 0013-GTR18882190-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18882190-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Human CCL22 protein (Active) spans the amino acid sequence from region 25-93aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Product Name Alternative
A 152E5.1 protein, ABCD 1 protein, C C motif chemokine 22 protein, CC chemokine STCP 1 protein, CC chemokine STCP-1 protein, ccl 22 protein, Ccl22 protein, CCL22_HUMAN protein, Chemokine (C C motif) ligand 22 protein, DCBCK protein, Macrophage-derived chemokine protein, MDC protein, Small inducible cytokine subfamily A member 22 protein, Small-inducible cytokine A22 protein, STCP 1 protein, Stimulated T cell chemotactic protein 1 protein
UniProt
O00626
Expression Region
25-93aa
Tag
Tag-Free
Source
E.Coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 97% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml.
Form
Lyophilized powder
Molecular Weight
8.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4
AA Sequence
GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Related Products

CatalogName
GTR18881553-01Mouse CCL22 protein (Active)
GTR18986084-01Human CCL22 protein
GTR18881637-01Human CCL22 protein
GTR19025902-01Recombinant Human C-C motif chemokine 22 protein (CCL22) (Active)
GTR18882257-01Human CCL28 protein (Active)
GTR18882235-01Human CCL26 protein (Active)
GTR18882168-01Human CCL20 protein (Active)
GTR18882224-01Human CCL25 protein (Active)
GTR18882213-01Human CCL24 protein (Active)
GTR18882201-01Human CCL23 protein (Active)

Alternative Products

CatalogName
MBS969213-01Recombinant Human C-C motif chemokine 22 protein (CCL22) (Active)
RPC28901-01Recombinant Human C-C motif chemokine 22 protein (CCL22), Active Protein
MBS969276-01Recombinant Rat C-C motif chemokine protein (Ccl22) (Active)
MBS2569294-01Recombinant Human CCL22 Protein
UA040169-01MDC/CCL22 Protein, Human
MBS138908-01Human CCL22 Protein Lysate
TMPH-03844-01CCL22 Protein, Human, Recombinant
B2011842Human CCL22/MDC Protein
347958C-C motif chemokine 22, active (CCL22), Recombinant, Human
MBS969253-01Recombinant Mouse C-C motif chemokine 22 protein (Ccl22) (Active)

Popular Products