Products for Research Use Only
RegisterLogin

Yeast MDR1 protein

CAT: 0013-GTR18881179-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18881179-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Yeast MDR1 protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Name Alternative
ABC20 protein, ABCB1 protein, ABCB1B protein, CD243 protein, CLCS protein, GP170 protein, IBD13 protein, PGY1 protein, ATP-binding cassette sub-family B member 1 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 1 protein, CD243 antigen protein, colchicin sensitivity protein, doxorubicin resistance protein, multidrug resistance protein 1 protein, P-glycoprotein 1 protein, P-gp protein, PGY1P-GP protein, ATP binding cassette, sub family B (MDR/TAP), member 1 protein, MDR1 protein, MDR 1 protein, Multidrug resistance 1 protein, P glycoprotein 1 protein, P gp protein
UniProt
P16875
Expression Region
1-114aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Entamoeba histolytica
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
14.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI

Related Products

CatalogName
GTR18887599-01Human MDR1 protein
GTR18882100-01E.coli MDR1 protein
GTR17886402-01MDR1 Antibody
GTR18895918MDR1 peptide
GTR18895669MDR1 peptide
GTR18074597-01MDR1 Antibody
GTR18009541MDR1 Antibody
GTR17897309-01MDR1 Antibody
GTR17897311-01MDR1 Antibody (FITC)
GTR17886403-01MDR1 Antibody (HRP)

Alternative Products

CatalogName
OPCA02862-20UGMDR1 Recombinant Protein
NBP3-21373PEPMDR1/ABCB1 Recombinant Protein Antigen
abx300827-01Multidrug Resistance Protein (MDR1) Antibody
OPCA02862-500UGOPCA02862-500UG - MDR1 Recombinant Protein
324677-01Multidrug Resistance (MDR1, Chloroquine Resistance Protein)
MBS7160373Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MDR1 Polyclonal Antibody
TMPH-03139-01MDR1 Protein, Plasmodium falciparum, Recombinant (His & SUMO)
324679-01Multidrug Resistance (MDR1, Chloroquine Resistance Protein) (FITC)
H00005243-Q01-25ugRecombinant Human MDR1/ABCB1 Protein - (Dry Ice)
324678-01Multidrug Resistance (MDR1, Chloroquine Resistance Protein) (Biotin)

Popular Products