Products for Research Use Only

Mouse CXCL14 protein

CAT: 0013-GTR18881886-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18881886-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Mouse CXCL14 protein spans the amino acid sequence from region 23-99aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Name Alternative
C-X-C motif chemokine 14 protein, Chaemokine, CXC motif, ligand 14 protein, Chemokine (C-X-C motif) ligand 14 protein, Chemokine BRAK protein, CXC chemokine in breast and kidney protein, CXCL 14 protein, CXCL-14 protein, CXCL14 protein, CXL14_HUMAN protein, JSC protein, Kec protein, Kidney-expressed chemokine CXC protein, KS1 protein, MGC10687 protein, MGC124510 protein, MGC90667 protein, 1110031L23Rik protein, 1200006I23Rik protein, AI414372 protein, BMAC protein, bolekine protein, MIP 2 gamma protein, MIP-2G protein, MIP2G protein, MIP2gamma protein, NJAC protein, PRO273 protein, PSEC0212 protein, Scyb14 protein, Small Inducible Cytokine B14 protein, Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK) protein, Small Inducible Cytokine subfamily B, member 14 protein, Small-inducible cytokine B14 protein, UNQ240 protein, CXC-X3 protein, BRAKKEC protein, member 14 (BRAK) protein, MIP-2 gamma protein, NJACKec protein, SCYB14MGC10687 protein
UniProt
Q9WUQ5
Expression Region
23-99aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
13.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE