Products for Research Use Only

Mouse Scyb11 protein

CAT: 0013-GTR18881883-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18881883-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Mouse Scyb11 protein spans the amino acid sequence from region 22-98aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Name Alternative
Scyb11
UniProt
Q9JHH5
Expression Region
22-98aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
12.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ

Alternative Products

CatalogName
AP72068-01Recombinant Mouse C-X-C motif chemokine 11(Scyb11), partial
CSB-RP092874m-01Recombinant Mouse C-X-C motif chemokine 11 (Scyb11), partial
375228-01Scyb11, Recombinant, Mouse, aa22-98, His-Tag (C-X-C Motif Chemokine 11)
125500-BiotinCXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (Biotin)
125500-FITCCXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (FITC)
MBS6157329-01CXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (PE)
MBS6130814-01CXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (AP)
125500CXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11)
125499-HRPCXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (HRP)
125500-APCCXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (APC)