Products for Research Use Only
RegisterLogin

Human PROS26 protein

CAT: 0013-GTR18882268-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18882268-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Human PROS26 protein spans the amino acid sequence from region 46-264aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Name Alternative
PROS26
UniProt
P28070
Expression Region
46-264aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
51.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is GST-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE

Related Products

CatalogName
GTR18981670-01Human IF Protein
GTR18990079-01Human WAS Protein
GTR18990343-01Human Protein archease Protein
GTR18989547-01Human Protein Jumonji Protein
GTR18987610-01Human Protein FAM50A Protein
GTR18883467-01Human Protein E7 protein
GTR18989971-01Human Protein LRATD2 Protein
GTR18989911-01Human Protein SSX2 Protein
GTR18989899-01Human Protein FACM Protein
GTR18987667-01Human Protein CBFA2T2 Protein

Alternative Products

CatalogName
AR50131PU-NPSMB4 / PROS26 (46-264, His-tag) Human Protein
131953-APCPSMB4 (Proteasome Subunit beta Type-4, Proteasome beta Chain, Macropain beta Chain, Multicatalytic Endopeptidase Complex beta Chain, Proteasome Chain 3, HsN3, 26kD Prosomal Protein, PROS-26, HsBPROS26, PROS26) (APC)
131953-BiotinPSMB4 (Proteasome Subunit beta Type-4, Proteasome beta Chain, Macropain beta Chain, Multicatalytic Endopeptidase Complex beta Chain, Proteasome Chain 3, HsN3, 26kD Prosomal Protein, PROS-26, HsBPROS26, PROS26) (Biotin)
MBS6391114-01PSMB4 (Proteasome Subunit beta Type-4, Proteasome beta Chain, Macropain beta Chain, Multicatalytic Endopeptidase Complex beta Chain, Proteasome Chain 3, HsN3, 26kD Prosomal Protein, PROS-26, HsBPROS26, PROS26) (HRP)
131953PSMB4 (Proteasome Subunit beta Type-4, Proteasome beta Chain, Macropain beta Chain, Multicatalytic Endopeptidase Complex beta Chain, Proteasome Chain 3, HsN3, 26kD Prosomal Protein, PROS-26, HsBPROS26, PROS26)
131953-FITCPSMB4 (Proteasome Subunit beta Type-4, Proteasome beta Chain, Macropain beta Chain, Multicatalytic Endopeptidase Complex beta Chain, Proteasome Chain 3, HsN3, 26kD Prosomal Protein, PROS-26, HsBPROS26, PROS26) (FITC)
P9076-14CPSMB4 (Proteasome Subunit beta Type-4, Proteasome beta Chain, Macropain beta Chain, Multicatalytic Endopeptidase Complex beta Chain, Proteasome Chain 3, HsN3, 26kD Prosomal Protein, PROS-26, HsBPROS26, PROS26) (Azide Free)
029278PSMB4 (Proteasome Subunit beta Type-4, Proteasome beta Chain, 26kD Prosomal Protein, HsBPROS26, PROS-26, Macropain beta Chain, Multicatalytic Endopeptidase Complex beta Chain, Proteasome Chain 3, HsN3, PROS26) (FITC) discontinued
029276PSMB4 (Proteasome Subunit beta Type-4, Proteasome beta Chain, 26kD Prosomal Protein, HsBPROS26, PROS-26, Macropain beta Chain, Multicatalytic Endopeptidase Complex beta Chain, Proteasome Chain 3, HsN3, PROS26) discontinued
MBS6391120-01PSMB4 (Proteasome Subunit beta Type-4, Proteasome beta Chain, Macropain beta Chain, Multicatalytic Endopeptidase Complex beta Chain, Proteasome Chain 3, HsN3, 26kD Prosomal Protein, PROS-26, HsBPROS26, PROS26) (PE)

Popular Products