Products for Research Use Only
RegisterLogin

Human Parkin protein

CAT: 0013-GTR18881450-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18881450-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Human Parkin protein spans the amino acid sequence from region 1-465aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Name Alternative
E3 ubiquitin ligase protein, E3 ubiquitin protein ligase parkin protein, E3 ubiquitin-protein ligase parkin protein, LPRS 2 protein, LPRS2 protein, PARK 2 protein, PARK2 protein, Parkin 2 protein, Parkinson disease (autosomal recessive juvenile) 2 protein, Parkinson disease (autosomal recessive, juvenile) 2, parkin protein, Parkinson disease protein 2 protein, Parkinson juvenile disease protein 2 protein, Parkinson protein 2 E3 ubiquitin protein ligase protein, Parkinson protein 2, E3 ubiquitin protein ligase (parkin) protein, PRKN 2 protein, PRKN protein, PRKN2 protein
UniProt
O60260
Expression Region
1-465aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
67.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of His-SUMO-tag and expression region is 1-465aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV

Related Products

CatalogName
GTR19028179-01Recombinant Human E3 ubiquitin-protein ligase parkin (PARK2)
GTR19021243-01Recombinant Human E3 ubiquitin-protein ligase parkin (PARK2)
GTR18946547Parkin (PARK2) Human Over-expression Lysate
GTR18928202Parkin (PARK2) Human Over-expression Lysate
GTR18946558Parkin (PARK2) Human Over-expression Lysate
GTR18938728Parkin (PARK2) Human Over-expression Lysate
GTR18928203Parkin (PARK2) Human Over-expression Lysate
GTR19012559-01Parkin coregulated gene protein
GTR18835739-01Human E3 ubiquitin-protein ligase parkin (PARK2) ELISA Kit
GTR18058013-01Parkin Antibody

Alternative Products

CatalogName
PROTO60260-01Human Parkin Recombinant Protein
ATGP2517-100Recombinant human Parkin protein
B2014143Human Parkin Protein Active
MBS3802074-01Human Parkin Protein ELISA Kit
PAN-H5543-500ugHuman Parkin Protein, His Tag
JL11195-01Human Parkin Protein (PP) ELISA Kit
abx167864-01Human E3 Ubiquitin-Protein Ligase Parkin (PRKN) Protein
R1522hHuman PACRG / Parkin coregulated gene protein Recombinant Protein
MBS2881105-01Human Parkin coregulated gene protein ELISA Kit
MBS9420523-01Recombinant Human E3 ubiquitin-protein ligase parkin

Popular Products