Mouse Mast Cell Chymase protein

CAT: 0013-GTR18880884-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18880884-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Mouse Mast Cell Chymase protein spans the amino acid sequence from region 22-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Name Alternative

Alpha-chymase protein, Chymase 1 protein, Chymase 1 mast cell protein, chymase 1 preproprotein transcript E protein, chymase 1 preproprotein transcript I protein, Chymase protein, Chymase, heart protein, Chymase, mast cell protein, CMA1 protein, CYH protein, CYM protein, Mast cell chymase 1 protein, Mast cell protease 3 protein, Mast cell protease 5 protein, Mast cell protease I protein, Mast cell protease III protein, Mcp-5 protein, MCP3P protein, Mcpt5 protein

UniProt

P21844

Expression Region

22-246aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-tag and expression region is 22-146aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILRE

UniProtKB · P21844

Chymase

CMA1_MOUSE · Mus musculus

View on UniProt ↗

Primary accession: P21844
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: Cma1
Protein existence: 1: Evidence at protein level
Organism: Mus musculus (Mouse)
Taxonomy ID: 10090
Alternative names: —
EC number: 3.4.21.39
Processing: Precursor
Secondary accessions: Q9R1F0

Protein keywords

Technical term

Direct protein sequencingReference proteome

PTM

Disulfide bondGlycoproteinZymogen

Molecular function

HydrolaseProteaseSerine protease

Cellular component

Secreted

Domain

Signal

Related Products

Catalog	Name
GTR18880882-01	Dog Mast Cell Chymase protein
GTR18882048-01	Monkey Mast Cell Chymase protein
GTR18881631-01	Dog Mast Cell Chymase protein
GTR18075995-01	Mast Cell Chymase Antibody
GTR18896057	Mast Cell Chymase Peptide
GTR18895558	Mast Cell Chymase peptide
GTR18577153-01	MAST CELL CHYMASE Antibody
GTR18576881	MAST CELL CHYMASE Antibody
GTR18881334-01	Human Mast Cell Chymase protein
GTR18804747-01	Mouse Mast Cell Chymase ELISA Kit

Alternative Products

Catalog	Name
M2414-05	Mast Cell Chymase
478224	CMA1 (Chymase, Chymase 1, Mast Cell)
GWB-1B005E	Mast cell chymase Antibody
M2414-HRP	Mast Cell Chymase (HRP)
M2414-FITC	Mast Cell Chymase (FITC)
511375	Mast Cell Chymase discontinued
545915	Chymase 1, Mast Cell
MBS6241741-01	Mast Cell Chymase (AP)
MBS618805-01	Mast Cell Chymase (CMA1)
MBS6242274-01	Mast Cell Chymase (APC)