E.coli lecA protein

CAT: 0013-GTR18880836-03Size: 1 mgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18880836-03Size:1 mg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This E.coli lecA protein spans the amino acid sequence from region 2-122aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Name Alternative

LecA, pa1L, PA2570, PA-I galactophilic lectin, PA-IL, Galactose-binding lectin

UniProt

Q05097

Expression Region

2-122aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of PA-I galactophilic lectin chain of His-tag and expression region is 2-122aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS

UniProtKB · Q05097

PA-I galactophilic lectin

PA1L_PSEAE · Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

View on UniProt ↗

Primary accession: Q05097
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: lecA
Protein existence: 1: Evidence at protein level
Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Taxonomy ID: 208964
Alternative names: PA-IL
EC number: —
Processing: —
Secondary accessions: —

Protein keywords

Technical term

3D-structureDirect protein sequencingReference proteome

Cellular component

CytoplasmPeriplasm

Ligand

Lectin

Related Products

Catalog	Name
GTR17887868-01	LecA Antibody
GTR17887902-01	LecA Antibody (Biotin)
GTR17887891-01	LecA Antibody (FITC)
GTR17887880-01	LecA Antibody (HRP)
GTR18886159-01	E. coli FimF41a protein
GTR18886129-01	E. coli rpoS protein
GTR18885856-01	E. coli oppA protein
GTR18885723-01	E. coli glmU protein
GTR18887564-01	E. coli hdhA protein
GTR18887559-01	E. coli ampC protein

Alternative Products

Catalog	Name
OPCA01975-20UG	LecA Recombinant Protein
TMPH-03174-01	LecA Protein, Pseudomonas aeruginosa, Recombinant (His)
EKC40798	E. coli Protein (E. Coli P) Elisa Kit
TRP-00173-01	E.coli Bacterial protein
E1370-02	Rec A Protein (E. coli)
abx263107-01	E.Coli Thioredoxin Protein
OOPA00105-5UG	LACTB E.coli Protein
OPPA02071-10UG	G6PD E.Coli Protein
OPPA00039-5UG	HchA E.Coli Protein
OPPA02246-5UG	SKP E. Coli Protein