Recombinant Xenopus laevis Decapping and exoribonuclease protein (dxo)

• Product Name Alternative:

  (DXO) (5'-3' exoribonuclease DXO) (Dom-3 homolog Z) (NAD-capped RNA hydrolase DXO) (DeNADding enzyme DXO)

• Abbreviation:

  Recombinant Xenopus laevis dxo protein

• Gene Name:

  Dxo

• UniProt:

  Q5HZT0

• Expression Region:

  1-401aa

• Organism:

  Xenopus laevis (African clawed frog)

• Target Sequence:

  MEGNKSMQREKIDRPMKRGPEQNSLSPPLAKCPFMSCSSLKTLHSLYQGSFPFYRLPSEVGHFSLDENRQYHQDNRKLRYYSPPVGIREKGSPGWNVMDGYESHYVRRNEDEKEGLLHILTWLEKNRGVLGAHVEGGSKRPIDRDFVTWRGHLTKILCTPYETQEGWLLAVTLFKGTFYISEQETEAAQKKRKERSLEQERLMYSGYKFESYICADSPDRQPSQSAVVNTNEGFCSVLLARLTSHSLLISGEVDCTDPSAKKSIPPTCYIELKSSAQIRNPHQQRSFNRYKLLKWWCQSFLLGIPIIVAGFRSPEGRIVSLETFKTSDIPHLVRGERNSWDPAVCMNFCNKFLSHIKSVVTRDDPRLVYLFAWEPGCDVTFTVHTDPEYTILPSWYVNSVN

• Tag:

  N-terminal 6xHis-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Decapping enzyme for NAD-capped RNAs: specifically hydrolyzes the nicotinamide adenine dinucleotide (NAD) cap from a subset of RNAs by removing the entire NAD moiety from the 5'-end of an NAD-capped RNA. The NAD-cap is present at the 5'-end of some RNAs and snoRNAs. In contrast to the canonical 5'-end N7 methylguanosine (m7G) cap, the NAD cap promotes mRNA decay. Also acts as a non-canonical decapping enzyme that removes the entire cap structure of m7G capped or incompletely capped RNAs and mediates their subsequent degradation. Specifically degrades pre-mRNAs with a defective 5'-end m7G cap and is part of a pre-mRNA capping quality control. Has decapping activity toward incomplete 5'-end m7G cap mRNAs such as unmethylated 5'-end-capped RNA (cap0), while it has no activity toward 2'-O-ribose methylated m7G cap (cap1) . Also has 5'-3' exoribonuclease activities: The 5'-end monophosphate RNA is then degraded by the 5'-3' exoribonuclease activity, enabling this enzyme to decap and degrade incompletely capped mRNAs. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5'-end triphosphate to release pyrophosphates. Exhibits decapping activity towards FAD-capped RNAs. Exhibits decapping activity towards dpCoA-capped RNAs in vitro.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  50.3 kDa

• References & Citations:

  1 NIH - Xenopus Gene Collection (XGC) project Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length