Recombinant Mouse Interferon alpha-inducible protein 27-like protein 2A (Ifi27l2a)

CAT:
399-CSB-CF840289MO-01
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Interferon alpha-inducible protein 27-like protein 2A (Ifi27l2a) - image 1

Recombinant Mouse Interferon alpha-inducible protein 27-like protein 2A (Ifi27l2a)

  • Product Name Alternative:

    (Interferon-stimulated gene 12 protein) (ISG12)
  • Abbreviation:

    Recombinant Mouse Ifi27l2a protein
  • Gene Name:

    Ifi27l2a
  • UniProt:

    Q8R412
  • Expression Region:

    25-90aa
  • Organism:

    Mus musculus (Mouse)
  • Target Sequence:

    AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL
  • Tag:

    N-terminal 10xHis-tagged
  • Type:

    CF Transmembrane Protein & In Stock Protein
  • Source:

    In vitro E.coli expression system
  • Field of Research:

    Others
  • Relevance:

    May be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors . Through the regulation of NR4A1 transcriptional activity, may play a role in the vascular response to injury .
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    7.3 kDa
  • References & Citations:

    "The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors." Papac-Milicevic N., Breuss J.M., Zaujec J., Ryban L., Plyushch T., Wagner G.A., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass C.K., Binder C.J., Uhrin P., Binder B.R. Circ. Res. 110:E50-E63 (2012)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein