Viral WHV protein

CAT: 0013-GTR18881039-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18881039-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Viral WHV protein spans the amino acid sequence from region 1-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Name Alternative

HBx Peptide X pX

UniProt

P17401

Expression Region

1-141aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Woodchuck hepatitis B virus (isolate 8) (WHV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL

UniProtKB · P17401

Protein X

X_WHV5 · Woodchuck hepatitis B virus (isolate 8)

View on UniProt ↗

Primary accession: P17401
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: X
Protein existence: 3: Inferred from homology
Organism: Woodchuck hepatitis B virus (isolate 8) (WHV)
Taxonomy ID: 10433
Alternative names: —
EC number: —
Processing: —
Secondary accessions: —

Protein keywords

Biological process

Activation of host NF-kappa-B by virusApoptosisHost G2/M cell cycle arrest by virusHost-virus interactionModulation of host cell cycle by virusTranscriptionTranscription regulation

Molecular function

Activator

Cellular component

Host cytoplasmHost mitochondrionHost nucleus

Related Products

Catalog	Name
GTR19283580	Viral ADENOVIRUS protein
GTR18883493-01	Viral Nucleoprotein protein
GTR18883482-01	Viral Nucleoprotein protein
GTR18883465-01	Viral Glycoprotein protein
GTR18883147-01	Viral VP30 protein
GTR18882925-01	Viral VACWR034 protein
GTR18882921-01	Viral GPC protein
GTR18882875-01	Viral GAG protein
GTR18882781-01	Viral UL131 protein
GTR18882739-01	Viral VACWR074 protein

Alternative Products

Catalog	Name
MBS7043605-01	Viral replication protein A28
30-1259	Feline Viral Rhinotracheitis protein
MBS540387-01	Viral Protein U Antibody
MBS8434679-01	Viral MIP-2 HSV Viral MIP-2 Recombinant Protein Lyophilized
NBP2-61442-250IU	Recombinant Viral PreScission Protease Protein
MBS5400232-01	Viral Protein U Antibody BIOTIN
OPPA02441-5UG	OPPA02441-5UG - MIP2 Viral Protein
8976-BR-025	Recombinant Viral 136R/Y136 Protein
CD00002	Recombinant Viral MIP-2 protein
519636-01	9HIV1 (Protein Vpu, Viral protein U)