UBE2M, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


UBE2M, Human
Description :
UBE2M Protein is a crucial mediator in the ubiquitin-like protein NEDD8 conjugation pathway. It accepts NEDD8 from the UBA3-NAE1 E1 complex, covalently attaching it to target proteins like CUL1, CUL2, CUL3, and CUL4, particularly interacting with the E3 ubiquitin ligase RBX1. This specificity in neddylating specific targets suggests a pivotal role in regulating cellular processes, notably contributing to cell proliferation. UBE2M Protein, Human is the recombinant human-derived UBE2M protein, expressed by E. coli , with tag free.Product Name Alternative :
UBE2M Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/ube2m-protein-human.htmlPurity :
98.0Smiles :
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLKMolecular Formula :
9040 (Gene_ID) P61081 (M1-K183) (Accession)Molecular Weight :
19-25.0 kDaShipping Conditions :
Dry ice.Storage Conditions :
Stored at -80°C for 1 yearScientific Category :
Recombinant Proteins

