UBE2M, Human

• Description :

  UBE2M Protein is a crucial mediator in the ubiquitin-like protein NEDD8 conjugation pathway. It accepts NEDD8 from the UBA3-NAE1 E1 complex, covalently attaching it to target proteins like CUL1, CUL2, CUL3, and CUL4, particularly interacting with the E3 ubiquitin ligase RBX1. This specificity in neddylating specific targets suggests a pivotal role in regulating cellular processes, notably contributing to cell proliferation. UBE2M Protein, Human is the recombinant human-derived UBE2M protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  UBE2M Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/ube2m-protein-human.html

• Purity :

  98.0

• Smiles :

  MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

• Molecular Formula :

  9040 (Gene_ID) P61081 (M1-K183) (Accession)

• Molecular Weight :

  19-25.0 kDa

• Shipping Conditions :

  Dry ice.

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins