Recombinant Escherichia coli Heat-labile enterotoxin B chain (eltB)

CAT:
399-CSB-EP333747ENL-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Escherichia coli Heat-labile enterotoxin B chain (eltB) - image 1

Recombinant Escherichia coli Heat-labile enterotoxin B chain (eltB)

  • CAS Number:

    9000-83-3
  • Gene Name:

    eltB
  • UniProt:

    P32890
  • Expression Region:

    22-124aa
  • Organism:

    Escherichia coli
  • Target Sequence:

    APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Source:

    E.coli
  • Field of Research:

    Others
  • Assay Type:

    In Stock Protein
  • Relevance:

    The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length of Mature Protein
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    19.2 kDa
  • References & Citations:

    "Structure of m-carboxyphenyl-alpha-D-galactopyranoside complexed to heat-labile enterotoxin at 1.3 A resolution: surprising variations in ligand-binding modes." Minke W.E., Pickens J., Merritt E.A., Fan E., Verlinde C.L., Hol W.G. Acta Crystallogr D Biol Crystallogr 56:795-804 (2000)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.