Recombinant Dog Growth hormone receptor (GHR), partial

CAT:
399-CSB-EP009411DO-01
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Dog Growth hormone receptor (GHR), partial - image 1

Recombinant Dog Growth hormone receptor (GHR), partial

  • Product Name Alternative:

    (GH receptor) (Somatotropin receptor) (GH-binding protein) (GHBP) (Serum-binding protein)
  • Abbreviation:

    Recombinant Dog GHR protein, partial
  • Gene Name:

    GHR
  • UniProt:

    Q9TU69
  • Expression Region:

    19-264aa
  • Organism:

    Canis lupus familiaris (Dog) (Canis familiaris)
  • Target Sequence:

    FSGSEATPTILGSASQSLQRVNPGLGTNSSEKPKFTKCRSPELETFSCHWTDGVRHGLKNAGSVQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLKYELQYKEVNESQWKMMDPVSATSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEALYVTLPQMSPFACEEDFQ
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway. ; The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    35.5 kDa
  • References & Citations:

    "Expression and molecular characterization of the growth hormone receptor in canine mammary tissue and mammary tumors." van Garderen E., van der Poel H.J.A., Swennenhuis J.F., Wissink E.H.J., Rutteman G.R., Hellmen E., Mol J.A., Schalken J.A. Endocrinology 140:5907-5914 (1999)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial