Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)

CAT:
399-CSB-YP750592RA-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active) - image 1
Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active) - image 2
Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active) - image 3
Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active) - image 4
Thumbnail 1
Thumbnail 2
Thumbnail 3
Thumbnail 4

Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)

  • Gene Name:

    Ly6g6d
  • UniProt:

    Q6MG58
  • Expression Region:

    20-108aa
  • Organism:

    Rattus norvegicus
  • Target Sequence:

    QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
  • Tag:

    N-terminal 6xHis-tagged
  • Source:

    Yeast
  • Field of Research:

    Immunology
  • Assay Type:

    Active Protein & In Stock Protein
  • Endotoxin:

    Less than 1.0 EU/ug as determined by LAL method.
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 5 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA2HU). The EC50 is 4.245-5.843 μg/mL.
  • Length:

    Full Length of Mature Protein
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    11.7 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3