Products for Research Use Only

BCL2, Human (His)

CAT: 0804-HY-P7537-01Size: 50 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7537-01Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
BCL2 Protein regulates the mitochondrial membrane permeability, and inhibits the caspase activity, thereby suppressing the apoptosis in various cell types. BCL2 Protein interacts with BECN1 and AMBRA1, and inhibits the autophagy. BCL2 Protein, Human (His) is the human-derived resombinant BCL2 Protein that is expressed in in E. coli with a His tag at the C-terminus.
Product Name Alternative
BCL2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bcl2-protein-human-his.html
Purity
98.0
Smiles
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Molecular Formula
596 (Gene_ID) P10415-1 (M1-D211) (Accession)
Molecular Weight
Approximately 22-27 kDa
References & Citations
[1]Print CG, et al. Apoptosis regulator bcl-w is essential for spermatogenesis but appears otherwise redundant. Proc Natl Acad Sci U S A. 1998 Oct 13;95 (21) :12424-31.|[2]Iwata A, et al., Extracellular administration of BCL2 protein reduces apoptosis and improves survival in a murine model of sepsis. PLoS One. 2011 Feb 24;6 (2) :e14729.|[3]Iwata A, et al., Extracellular BCL2 proteins are danger-associated molecular patterns that reduce tissue damage in murine models of ischemia-reperfusion injury. PLoS One. 2010 Feb 8;5 (2) :e9103.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins