BCL2, Human (His)

CAT:
804-HY-P7537-01
Size:
50 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: Yes
BCL2, Human (His) - image 1

BCL2, Human (His)

  • Description:

    BCL2 Protein regulates the mitochondrial membrane permeability, and inhibits the caspase activity, thereby suppressing the apoptosis in various cell types. BCL2 Protein interacts with BECN1 and AMBRA1, and inhibits the autophagy. BCL2 Protein, Human (His) is the human-derived resombinant BCL2 Protein that is expressed in in E. coli with a His tag at the C-terminus.
  • Product Name Alternative:

    BCL2 Protein, Human (His), Human, E. coli
  • UNSPSC:

    12352202
  • Type:

    Recombinant Proteins
  • Assay Protocol:

    https://www.medchemexpress.com/cytokines/bcl2-protein-human-his.html
  • Purity:

    98.0
  • Smiles:

    MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
  • Molecular Formula:

    596 (Gene_ID) P10415-1 (M1-D211) (Accession)
  • Molecular Weight:

    Approximately 22-27 kDa
  • References & Citations:

    [1]Print CG, et al. Apoptosis regulator bcl-w is essential for spermatogenesis but appears otherwise redundant. Proc Natl Acad Sci U S A. 1998 Oct 13;95 (21) :12424-31.|[2]Iwata A, et al., Extracellular administration of BCL2 protein reduces apoptosis and improves survival in a murine model of sepsis. PLoS One. 2011 Feb 24;6 (2) :e14729.|[3]Iwata A, et al., Extracellular BCL2 proteins are danger-associated molecular patterns that reduce tissue damage in murine models of ischemia-reperfusion injury. PLoS One. 2010 Feb 8;5 (2) :e9103.
  • Shipping Conditions:

    Dry ice
  • Storage Conditions:

    Stored at -80°C for 1 year
  • Scientific Category:

    Recombinant Proteins