Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1379823-02	Recombinant Sarcophaga peregrina AT-rich binding protein
MBS1379823-05	Recombinant Sarcophaga peregrina AT-rich binding protein
MBS1379823-01	Recombinant Sarcophaga peregrina AT-rich binding protein
MBS1379823-03	Recombinant Sarcophaga peregrina AT-rich binding protein
MBS1379823-04	Recombinant Sarcophaga peregrina AT-rich binding protein
MBS1054399-02	Recombinant Human AT-rich interactive domain-containing protein 3C (ARID3C)
MBS1054399-03	Recombinant Human AT-rich interactive domain-containing protein 3C (ARID3C)
MBS1313493-002mgBaculovirus	Recombinant Human AT-rich interactive domain-containing protein 3A (ARID3A)
MBS1313493-002mgEColi	Recombinant Human AT-rich interactive domain-containing protein 3A (ARID3A)
MBS1313493-01mgEColi	Recombinant Human AT-rich interactive domain-containing protein 3A (ARID3A)

Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial

CAT:

399-CSB-EP702965HU-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial

Gene Name: ARID4B
UniProt: Q4LE39
Expression Region: 167-415aa
Organism: Homo sapiens
Target Sequence: KQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNK
Tag: N-terminal 6xHis-tagged
Source: E.coli
Field of Research: Others
Assay Type: In Stock Protein
Relevance: Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the Sin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. Plays a role in the regulation of epigenetic modifications at the PWS/AS imprinting center near the SNRPN promoter, where it might function as part of a complex with RB1 and ARID4A. Involved in spermatogenesis, together with ARID4A, where it functions as a transcriptional coactivator for AR and enhances expression of genes required for sperm maturation. Regulates expression of the tight junction protein CLDN3 in the testis, which is important for integrity of the blood-testis barrier. Plays a role in myeloid homeostasis where it regulates the histone methylation state of bone marrow cells and expression of various genes involved in hematopoiesis. May function as a leukemia suppressor.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 32.8 kDa
References & Citations: "Characterization of BRCAA1 and its novel antigen epitope identification." Cui D., Jin G., Gao T.W., Sun T., Tian F., Estrada G.G., Gao H., Sarai A. Cancer Epidemiol. Biomarkers Prev. 13:1136-1145 (2004)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP702965HU-03	Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial
CSB-EP702965HU-01	Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial
CSB-EP002058HU1-02	Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial
CSB-BP002058HU1-01	Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial
CSB-BP002058HU1-03	Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial
CSB-EP702965HU-02	Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial
CSB-EP002058HU1-01	Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial
CSB-EP002058HU1-03	Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial
CSB-BP002058HU1-02	Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial
CSB-YP667554MO-02	Recombinant Mouse AT-rich interactive domain-containing protein 5A (Arid5a)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on