Products for Research Use Only
RegisterLogin

YTFE, E.coli (GST)

CAT: 0804-HY-P700386Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P700386Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
YTFE protein is a diiron-containing molecule that is crucially involved in the repair of iron-sulfur clusters under oxidative and nitrosative stress conditions. As a homodimer, YTFE plays a key role in mitigating damage to iron-sulfur clusters, a process necessary to maintain the integrity and function of various proteins within cells. YTFE Protein, E.coli (GST) is the recombinant E. coli-derived YTFE protein, expressed by E. coli , with N-GST labeled tag.
Product Name Alternative
YTFE Protein, E.coli (GST), E.coli, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ytfe-protein-e-coli-gst.html
Smiles
MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
Molecular Formula
66671871 (Gene_ID) P69506 (M1-E220) (Accession)
Molecular Weight
51.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P700385YcbX, E.coli (GST)
HY-P700311Sorcin/SRI, Human (E.coli, GST)
HY-P71097-01TrpA, E.coli
HY-P703429PhoA, E.coli
HY-P701911HflC, E.coli
HY-157351E.Coli Broth
HY-P75559AcnB, E. coli
HY-P71487-01HtpG, E.coli
HY-P2869-01β-Galactosidase, E. coli
HY-P71500TsaE, E.coli

Alternative Products

CatalogName
TMPH-00641-01YTFE Protein, E. coli, Recombinant (GST)
586867-01E. Coli Iron-sulfur Cluster Repair Protein ytfE, Active, Recombinant, Human, GST-Tag, aa1-220 (ytfE)
GTR18886460-01E. coli YTFE protein
RPC27041-01Recombinant E. coli Iron-sulfur cluster repair protein ytfE (ytfE), Active Protein
MBS1380043-01Recombinant Escherichia coli Iron-sulfur cluster repair protein YtfE (ytfE)
AP78310Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active)
MBS1426304-01Recombinant Escherichia coli O6 Iron-sulfur cluster repair protein YtfE (ytfE)
MBS1084657-01Recombinant Escherichia coli O8 Iron-sulfur cluster repair protein YtfE (ytfE)
MBS1059771-01Recombinant Escherichia coli O81 Iron-sulfur cluster repair protein YtfE (ytfE)
MBS1364592-01Recombinant Escherichia coli O157:H7 Iron-sulfur cluster repair protein YtfE (ytfE)

Popular Products