Recombinant Mouse Melanocyte-stimulating hormone receptor (Mc1r) -VLPs
CAT:
399-CSB-MP013558MO-01
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Mouse Melanocyte-stimulating hormone receptor (Mc1r) -VLPs
- CAS Number: 9000-83-3
- Gene Name: Mc1r
- UniProt: Q01727
- Expression Region: 1-315aa
- Organism: Mus musculus
- Target Sequence: MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW
- Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
- Source: Mammalian cell
- Field of Research: Others
- Assay Type: MP-VLP Transmembrane Protein & Developed Protein
- Relevance: Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Mediates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), via regulation of cAMP signaling in melanocytes.
- Purity: The purity information is not available for VLPs proteins.
- Activity: Not Test
- Length: Full Length
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.
- Molecular Weight: 36.6 kDa
- References & Citations: "Molecular and functional analyses of the human and mouse genes encoding AFG3L1, a mitochondrial metalloprotease homologous to the human spastic paraplegia protein." Kremmidiotis G., Gardner A.E., Settasatian C., Savoia A., Sutherland G.R., Callen D.F. Genomics 76:58-65 (2001)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.