Prox-1 (fragment) Recombinant Protein
CAT:
209-300-052
Size:
5 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Prox-1 (fragment) Recombinant Protein
- Description: Prox-1 is a homeobox gene and acts as a master switch for lymphatic endothelial phenotype. Expression of Prox-1 in blood endothelial cells induces expression of other lymphatic marker genes. Together with Podoplanin, Prox-1 can be used to reliably distinguish lympathic vessels from blood vessels. Prox1 is expressed in CNS, eye, pancreas, liver and heart, and it is one of the most specific and reliable markers for lymphatic endothelial cells. The highly conserved C-terminal part of the homeobox transcription factor Prox1 was produced in E. coli. It was not tested for activity and can be used as positive control e.g. in Western analysis.
- Synonyms: PROX1; W117m
- CAS Number: 9000-83-3
- NCBI Gene ID: 5629
- UniProt: Q92786
- Accession Number: NP_002754
- Accession Number mRNA: NM_002763
- Gene Location: 1q32.2-q32.3
- Host: E. coli
- Origin Species: Human
- Species Reactivity: Human
- Sequence: MAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE
- Detection Range: Control for Western Blotting. Biological activity not tested.
- Purity: > 95% by SDS-PAGE
- Length: 192
- Form: Lyophilized
- Buffer: PBS
- Reconstitution: Centrifuge vial prior to opening. The lyophilized Prox-1 should be reconstituted in water to a concentration not lower than 50 µg/ml.
- Molecular Weight: 22.35 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: The lyophilized protein is stable for a few weeks at room temperature, but best stored at –20°C. Reconstituted Prox-1 should be stored in working aliquots at –20°C. Avoid repeated freeze-thaw cycles.